PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03867.1.g00040.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB_related
Protein Properties Length: 1495aa    MW: 162962 Da    PI: 5.9471
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03867.1.g00040.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.73.2e-09669711347
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +WT+eE e++ +  +++G++ +++I++ +  ++t  +c+++++k+
  Zpz_sc03867.1.g00040.1.sm.mkhc 669 PWTQEEKEIFMETLAKFGKD-FSKISSFIT-HKTTADCVEFYYKH 711
                                     8*****************99.********9.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.21E-15653714IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-7660714IPR009057Homeodomain-like
PROSITE profilePS5129315.886665716IPR017884SANT domain
SMARTSM007171.8E-8666714IPR001005SANT/Myb domain
PfamPF002492.6E-7668711IPR001005SANT/Myb domain
PROSITE profilePS5129312.666873924IPR017884SANT domain
SMARTSM007171.3E-6874922IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-4877919IPR009057Homeodomain-like
SuperFamilySSF466893.67E-9877924IPR009057Homeodomain-like
CDDcd001675.75E-5878916No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1495 aa     Download sequence    Send to blast
MPLGYTPSRS DRYWMDDEGG GYKGFSRYGG GRRDGRDMRG SYRRSPFRSY GNDFSRNHQE  60
QPPPPPPRRS PLRSVALPIY DPPGNRVDRG DRDSLPRVTP WRRRENRSEA AGAAGAGHVS  120
AGQSALLAAS GNEVSAHPPA VTSPHGAEEE APRKKARLGW GQGLAKYEKQ KVQGPTDPSE  180
DVALGSPAES SFSCTCSCAM HIDDCCANIS TSAMCIPSCG AATSTSTMRI PGCCTITSIY  240
GMCISGFCSR TCTSRMCISS SSAITSICGT TCTCTSTMCI CDTTCTCTST MCISATEVKS  300
CDLTANTVLN STQDTPGADD QACNNEFPIK IDQLGDDCID SLATLLAKFL EHDSCPGDSK  360
DPSSTSKLLL LKESISKEIE KIELEIDSLE GELKSVYTVA PEDSPTGVTY TENISPPSGT  420
SKVPGCDKSH VKEPRELSPF PKIPIVQDAN AKDAESMDIE TAPVHNAKTA SEESAACPEN  480
QAQAAADVGP VNVSGVAEPQ IDVDNERLEV SSWHIDTDSV KADGGVDLRG RQCLYPNHDL  540
LSSVTSSNHD IAKEANESVF KCLSGDTPRL DLLDTSHVSI ERKNVSFIKE KLMLRKSRLS  600
FKEQALTFKF RALRYLWKED MRVKRRRNYF KMPALIINEK EKECSRFLSK NGLIEDPVAV  660
EKERVMINPW TQEEKEIFME TLAKFGKDFS KISSFITHKT TADCVEFYYK HHKSDSFREV  720
KKLLDQHQQQ QPTSTFLGTK SGKKWNREPN AASLDILGIA SAVAAQGLEY EKRVEKFSAK  780
SLIRNVSNVS FMARKSSREC FDNTSLHERE SVAADVLAGI CGTLSPEGMS SCITSSADPG  840
QKINITRMEN ALTLEIGKNV DDEDTLSDIE CEVDPVDWND DEKQIFIEAM NNYGKDFARI  900
SSCVKSKSYE QCKVFFSKAR KSLGLDLIHQ GAADINMPTS DTNGGRSDTD EACAAEMDSV  960
ICSTQSFAKT EMDVCPTERA VQGPSSCVIS KQTEGDGSND CNVLDVNTEC ENKADKTCDD  1020
QKRFNEVAHQ SQCGPIDINC PETTEKLEGT ADTVDQMNMH NSSAVISSKD QPEARMDGCS  1080
HPALDNALVK AGTADPSASI VAESGIKENI HHFSNPPSTS SYQHSMPRDK PPSKPKPQVT  1140
PLTPKDLMPV QFSSVLPDPT SIRFEGIASI TTPNFEDNGN RACNALEAKD MNKYPAFKEQ  1200
SQAGQHDLLF HNIDGYKKHL ATEASIFSER NTCGTVSTSQ SDRFTVTKFQ NGRSSSLGGL  1260
PNTKGIHWDR EHNEVSDGSL RHCSHNTSSD SNEQIKRLGD VKLFGQILSH QSSQNSGSSC  1320
NGSINKPSLP NVDTSSMRLL NSPRDHVSCS PRPVATGHLG LDDLSVRTYG HLDGSTTQPE  1380
PLPTMTKCQT SLSGVPFYSA KNGTRGMFSG YQQPLMQAHQ SDPKRLERYS DPHKRNGMEF  1440
ISGFQQQPGK VSLFGGAGVL VSGVSDPVAA LKAQYGPGSK ITSCDVDPWK DIGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D2e-14632718994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C2e-14632718994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960366.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_004960367.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_012700232.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
TrEMBLK3Z3350.0K3Z335_SETIT; Uncharacterized protein
STRINGSi020953m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.15e-69MYB family protein